Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Interleukin-11 (Il11)

This Recombinant Rat Interleukin-11 (Il11) spans the amino acid sequence from region 22-199aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-11

UniProt

Q99MF5

Expression Region

22-199aa

Tag

C-terminal 10xHis-tagged

Source

Baculovirus

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHNLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYFRHVQWLRRAAGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPAVPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL2L12 Recombinant Antibody, Cy5 Conjugated
bsm-62094R-Cy5-TR 20 µL

BCL2L12 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
TRNAS17 Adenovirus (Human)
48372051 1.0 mL

TRNAS17 Adenovirus (Human)

Sign In for Pricing
View Details
PIK3CG Polyclonal Antibody
MBS2566613-01 0.06 mL

PIK3CG Polyclonal Antibody

Sign In for Pricing
View Details
PIK3CG Polyclonal Antibody
MBS2566613-02 0.12 mL

PIK3CG Polyclonal Antibody

Sign In for Pricing
View Details
PIK3CG Polyclonal Antibody
MBS2566613-03 0.2 mL

PIK3CG Polyclonal Antibody

Sign In for Pricing
View Details
PIK3CG Polyclonal Antibody
MBS2566613-04 5x 0.2 mL

PIK3CG Polyclonal Antibody

Sign In for Pricing
View Details