Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine protease 1 (PRSS1)

This Recombinant Human Serine protease 1 (PRSS1) spans the amino acid sequence from region 24-247aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-trypsin; Cationic trypsinogen; Serine protease 1; Trypsin I; TRP1; TRY1'TRYP1

UniProt

P07477

Expression Region

24-247aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Octadecyl 3-(3,5-Di-tert-butyl-4-hydroxyphenyl)propionate
TRC-O239695-50G 50 g

Octadecyl 3-(3,5-Di-tert-butyl-4-hydroxyphenyl)propionate

Sign In for Pricing
View Details
HID1 (NM_030630) Human Over-expression Lysate
LY403066 100 µg

HID1 (NM_030630) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CITED4 activation kit by CRISPRa
GA116095 1 Kit

Human CITED4 activation kit by CRISPRa

Sign In for Pricing
View Details
HOXC8 (NM_022658) Human Recombinant Protein
TP761503 50 µg

HOXC8 (NM_022658) Human Recombinant Protein

Sign In for Pricing
View Details
UBXN10 antibody
FNab09215 100 µg

UBXN10 antibody

Sign In for Pricing
View Details
C16
SIH-498-5MG 5 mg

C16

Sign In for Pricing
View Details