Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pulmonary surfactant-associated protein A2 (SFTPA2), partial

This Recombinant Human Pulmonary surfactant-associated protein A2 (SFTPA2), partial spans the amino acid sequence from region 141-248aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PSP-A; PSPA; SP-A; SP-A2;35 kDa pulmonary surfactant-associated protein; Alveolar proteinosis protein; Collectin-5

UniProt

Q8IWL1

Expression Region

141-248aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Respiratory Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stxbp3a sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3936202 1.0 µg DNA

Stxbp3a sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Rabbit Anti RPS2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC)
IRBAMLRPS2AP203120UL 1 Each

Rabbit Anti RPS2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC)

Sign In for Pricing
View Details
Anti- Human Signaling Lymphocytic Activation Molecule/SLAM/CD150
IT-300-098M8-01 0.1 mg

Anti- Human Signaling Lymphocytic Activation Molecule/SLAM/CD150

Sign In for Pricing
View Details
Anti- Human Signaling Lymphocytic Activation Molecule/SLAM/CD150
IT-300-098M8-02 0.5 mg

Anti- Human Signaling Lymphocytic Activation Molecule/SLAM/CD150

Sign In for Pricing
View Details
SSPO siRNA (Human)
CRH8033-01 15 nmol

SSPO siRNA (Human)

Sign In for Pricing
View Details
SSPO siRNA (Human)
CRH8033-02 30 nmol

SSPO siRNA (Human)

Sign In for Pricing
View Details