Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Uncharacterized protein C1orf54 homolog

This Recombinant Mouse Uncharacterized protein C1orf54 homolog spans the amino acid sequence from region 17-148aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein L259

UniProt

Q8R2K8

Expression Region

17-148aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEYDHEEQLEEGDYYQVAYYYYTVTPNYDDFSVNFTVDYSVFESEDRLNRLNKEVTTTEAVETTASSYSLHTELMDPQNPVTTKPVTTEPVTTEPVTTEPQSPNQNDAMSTLQSPVSCFLLWTLLQGGVHFM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biological Safety Cabinet Class II BCBS-1205
BCBS-1205 1 Unit

Biological Safety Cabinet Class II BCBS-1205

Sign In for Pricing
View Details
MOPS Sodium Salt
TRC-M725273-5G 5 g

MOPS Sodium Salt

Sign In for Pricing
View Details
AMID (AIFM2) Rabbit Polyclonal Antibody
TA372285 100 µL

AMID (AIFM2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1,4-Dibutyl Benzene-1,4-dicarboxylate
TRC-D159391-500MG 500 mg

1,4-Dibutyl Benzene-1,4-dicarboxylate

Sign In for Pricing
View Details
Human DDX28 activation kit by CRISPRa
GA110975 1 Kit

Human DDX28 activation kit by CRISPRa

Sign In for Pricing
View Details
Ephrin A5 (EFNA5) (NM_001962) Human Over-expression Lysate
LY419623 100 µg

Ephrin A5 (EFNA5) (NM_001962) Human Over-expression Lysate

Sign In for Pricing
View Details