Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Activin beta-C chain, partial

This Recombinant Macaca fascicularis Activin beta-C chain, partial spans the amino acid sequence from region 237-352aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

G7PIV0

Expression Region

237-352aa

Tag

C-terminal 10xHis-HSA-tagged

Source

Mammalian cell

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

81.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GIDCQEGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHVAGMPGIAASFHTAVLNLLKANTAAGTTGGSSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Abcg5 (NM_031884) Mouse Tagged Lenti ORF Clone
MR224940L3 10 µg

Abcg5 (NM_031884) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SETX Polyclonal Antibody, FITC Conjugated
A60872-050 50 µL

SETX Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
TSGA10, NT (TSGA10, CEP4L, Testis-specific gene 10 protein, Testis development protein NYD-SP7) (FITC) discontinued
043359-FITC 200 µL

TSGA10, NT (TSGA10, CEP4L, Testis-specific gene 10 protein, Testis development protein NYD-SP7) (FITC) discontinued

Sign In for Pricing
View Details
Cat Zinc Finger Protein 385A (ZNF385A) ELISA Kit
MBS9937335 Inquire

Cat Zinc Finger Protein 385A (ZNF385A) ELISA Kit

Sign In for Pricing
View Details
Phospho-CrkL (Tyr251) Antibody
MBS9610667-01 0.05 mL

Phospho-CrkL (Tyr251) Antibody

Sign In for Pricing
View Details
Phospho-CrkL (Tyr251) Antibody
MBS9610667-02 0.1 mL

Phospho-CrkL (Tyr251) Antibody

Sign In for Pricing
View Details