Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Inhibin beta E chain (Inhbe)

This Recombinant Mouse Inhibin beta E chain (Inhbe) spans the amino acid sequence from region 237-350aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activin beta-E chain

UniProt

O08717

Expression Region

237-350aa

Tag

N-terminal hFc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPTCEPETPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPAGSSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE4A Protein Vector (Human) (pPB-C-His)
PV110258 500 ng

PDE4A Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Rat EphB1 MAb (Clone 917118)
MAB5422 100 µg

Rat EphB1 MAb (Clone 917118)

Sign In for Pricing
View Details
2,2'- (Cyclohexylimino) diethanol
268970-01 100 mg

2,2'- (Cyclohexylimino) diethanol

Sign In for Pricing
View Details
2,2'- (Cyclohexylimino) diethanol
268970-02 250 mg

2,2'- (Cyclohexylimino) diethanol

Sign In for Pricing
View Details
2,2'- (Cyclohexylimino) diethanol
268970-03 500 mg

2,2'- (Cyclohexylimino) diethanol

Sign In for Pricing
View Details
2,2'- (Cyclohexylimino) diethanol
268970-04 1 g

2,2'- (Cyclohexylimino) diethanol

Sign In for Pricing
View Details