Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Inhibin beta E chain (Inhbe)

This Recombinant Mouse Inhibin beta E chain (Inhbe) spans the amino acid sequence from region 237-350aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activin beta-E chain

UniProt

O08717

Expression Region

237-350aa

Tag

N-terminal hFc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPTCEPETPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPAGSSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cldn7 Mouse shRNA Plasmid (Locus ID 53624)
TR502960 1 Kit

Cldn7 Mouse shRNA Plasmid (Locus ID 53624)

Sign In for Pricing
View Details
HDLCQ1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
23155111 3x 1.0 µg

HDLCQ1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
IRAK1 Rabbit Monoclonal Antibody
E56G0241 100 µL

IRAK1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SNAPC4 (Small Nuclear RNA Activating Complex, Polypeptide 4, 190kD, OTTHUMP00000022583, FLJ13451, PTFalpha, SNAP190) (AP) discontinued
207884-AP 100 µL

SNAPC4 (Small Nuclear RNA Activating Complex, Polypeptide 4, 190kD, OTTHUMP00000022583, FLJ13451, PTFalpha, SNAP190) (AP) discontinued

Sign In for Pricing
View Details
G Protein-Coupled Receptor 143 (GPR143) Antibody
abx338878-01 20 µg

G Protein-Coupled Receptor 143 (GPR143) Antibody

Sign In for Pricing
View Details
G Protein-Coupled Receptor 143 (GPR143) Antibody
abx338878-02 50 µg

G Protein-Coupled Receptor 143 (GPR143) Antibody

Sign In for Pricing
View Details