Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human High mobility group protein B1 (HMGB1), partial

This Recombinant Human High mobility group protein B1 (HMGB1), partial spans the amino acid sequence from region 2-67aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

High mobility group protein 1 ; HMG-1

UniProt

P09429

Expression Region

2-67aa

Tag

N-terminal hFc-Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Retinoid X Receptor beta Antibody
DF13265-01 100 µL

Retinoid X Receptor beta Antibody

Sign In for Pricing
View Details
Retinoid X Receptor beta Antibody
DF13265-02 200 µL

Retinoid X Receptor beta Antibody

Sign In for Pricing
View Details
Lentiviral mouse Sugp1 shRNA (UAS) - Lentiviral mouseSugp1 shRNA (UAS, GFP) (25)
GTR15270440 1 Vial

Lentiviral mouse Sugp1 shRNA (UAS) - Lentiviral mouseSugp1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
APM2 (ADIRF) (NM_006829) Human Tagged Lenti ORF Clone
RC202414L1 10 µg

APM2 (ADIRF) (NM_006829) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Nafamostat Impurity 39
RM-N010639-01 10 mg

Nafamostat Impurity 39

Sign In for Pricing
View Details
Nafamostat Impurity 39
RM-N010639-02 25 mg

Nafamostat Impurity 39

Sign In for Pricing
View Details