Recombinant Xenopus laevis paqr8.L&abhd2.S Heterodimer Protein-VLPs
This Recombinant Xenopus laevis paqr8.L&abhd2.S Heterodimer Protein-VLPs spans the amino acid sequence from region 1-353aa&1-426aa. Purity: The purity information is not available for VLPs proteins.
Product Specifications
UniProt
Q801G4, A0A1L8GSQ0
Expression Region
1-353aa&1-426aa
Tag
C-terminal 6xHis-tagged (This tag can be tested only under denaturing conditions)
Source
Mammalian cell
Origin
Xenopus laevis (African clawed frog)
Field of Research
Metabolism Research; Stem Cell & Developmental Biology
Purity
The purity information is not available for VLPs proteins.
Form
Lyophilized powder
Molecular Weight
41.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
AA Sequence
MTTAILECISTLSISFQQLRRLPRFLEGGTTKMPLTVTDSDVPRLFREPYIQTGYRPTDQDWKYYFLSLFKKHNESVNVWTHLLVALAVVLRVVAFVEAGSLSLNVVSFPLYLYVLSSLTYLTCSILAHLLQSKSELAHYTFYFIDYVGVSTYQYGCALAHYYYTSNEAWYDKACYFFLPGAAFLGWLSCVGCCYAKYCYKRPYPVMRKILQVVPAGLAYILDISPVVHRIVTCHMEDYTDKAVWLHSLQMIFFIIGAYFFSCPVPEKYFPGSCDFIGHGHQIFHVFLGLCTLSQLEALFIDYQTRQEVFSARYSSNYTLMCCASFFLLILCSTFTAVYARRRIKEKLARKEL&MDAIVETPEMPAVFDGMKLAAVAAFLYIIVRSLNLKNPTAPPDLLYQDTALTRYLIKSCPLLTKEYIPPIIWGKSGHIQTALYGKMGRVSSPHPYGLRKYLTMPDGATATFDLFEPLAEHCTGENVTMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALTNIELTSPRMFTYGCTWEFGAMVNYIRKAFPQTQLIVVGFSLGGNIVCKYLGETASNQERVMCCVSVCQGYSASHAQDTFLQWDQLRRVYNFLMADNMKKIILSHRHILFGDGSKANRVLEDTDLSRLYTATSLMQIDDVVMRKFHGYKTVQEYYEAESCIRYLHNIHVPLMLVNSVDDPLVHDSLLTIPKTLAEKKENVLVVLPLHGGHLGFFEGAVLFPEPLTWMDKLIVQYSNAICQWERNKPQCSDVKQAAESDHK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog