Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis paqr8.L&abhd2.S Heterodimer Protein-VLPs

This Recombinant Xenopus laevis paqr8.L&abhd2.S Heterodimer Protein-VLPs spans the amino acid sequence from region 1-353aa&1-426aa. Purity: The purity information is not available for VLPs proteins.

Product Specifications

UniProt

Q801G4, A0A1L8GSQ0

Expression Region

1-353aa&1-426aa

Tag

C-terminal 6xHis-tagged (This tag can be tested only under denaturing conditions)

Source

Mammalian cell

Origin

Xenopus laevis (African clawed frog)

Field of Research

Metabolism Research; Stem Cell & Developmental Biology

Purity

The purity information is not available for VLPs proteins.

Form

Lyophilized powder

Molecular Weight

41.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

AA Sequence

MTTAILECISTLSISFQQLRRLPRFLEGGTTKMPLTVTDSDVPRLFREPYIQTGYRPTDQDWKYYFLSLFKKHNESVNVWTHLLVALAVVLRVVAFVEAGSLSLNVVSFPLYLYVLSSLTYLTCSILAHLLQSKSELAHYTFYFIDYVGVSTYQYGCALAHYYYTSNEAWYDKACYFFLPGAAFLGWLSCVGCCYAKYCYKRPYPVMRKILQVVPAGLAYILDISPVVHRIVTCHMEDYTDKAVWLHSLQMIFFIIGAYFFSCPVPEKYFPGSCDFIGHGHQIFHVFLGLCTLSQLEALFIDYQTRQEVFSARYSSNYTLMCCASFFLLILCSTFTAVYARRRIKEKLARKEL&MDAIVETPEMPAVFDGMKLAAVAAFLYIIVRSLNLKNPTAPPDLLYQDTALTRYLIKSCPLLTKEYIPPIIWGKSGHIQTALYGKMGRVSSPHPYGLRKYLTMPDGATATFDLFEPLAEHCTGENVTMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALTNIELTSPRMFTYGCTWEFGAMVNYIRKAFPQTQLIVVGFSLGGNIVCKYLGETASNQERVMCCVSVCQGYSASHAQDTFLQWDQLRRVYNFLMADNMKKIILSHRHILFGDGSKANRVLEDTDLSRLYTATSLMQIDDVVMRKFHGYKTVQEYYEAESCIRYLHNIHVPLMLVNSVDDPLVHDSLLTIPKTLAEKKENVLVVLPLHGGHLGFFEGAVLFPEPLTWMDKLIVQYSNAICQWERNKPQCSDVKQAAESDHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
BNC680633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL
BNC940218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL
BNC400270-100 1x 100 µL

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL
BNC880034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF647 conjugate, 0.1mg/mL
BNC470305-500 1x 500 µL

CD95 (B-R18), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL
BNC940304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details