Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interferon alpha-4 (Ifna4)

This Recombinant Mouse Interferon alpha-4 (Ifna4) spans the amino acid sequence from region 25-186aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFN-alpha-4

UniProt

P07351

Expression Region

25-186aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CDLPHTYNLGNKRALTVLEEMRRLPPLSCLKDRKDFGFPLEKVDNQQIQKAQAILVLRDLTQQILNLFTSKDLSATWNATLLDSFCNDLHQQLNDLKACVMQEPPLTQEDSLLAVRTYFHRITVYLRKKKHSLCAWEVIRAEVWRALSSSTNLLARLSEEKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Phenyl 5Beta-Dihydrocortisone 1,3-Dioxane
TRC-P319360-25MG 25 mg

2-Phenyl 5Beta-Dihydrocortisone 1,3-Dioxane

Sign In for Pricing
View Details
Nortropine Hydrochloride
TRC-N692100-500MG 500 mg

Nortropine Hydrochloride

Sign In for Pricing
View Details
Diclofenac Isopropyl Ester
TRC-D436458-5MG 5 mg

Diclofenac Isopropyl Ester

Sign In for Pricing
View Details
MDM2 (SMP14), CF488A conjugate, 0.1mg/mL
BNC881721-100 1x 100 µL

MDM2 (SMP14), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KLK14 Polyclonal Antibody
E-AB-13367-01 20 µL

KLK14 Polyclonal Antibody

Sign In for Pricing
View Details
KLK14 Polyclonal Antibody
E-AB-13367-02 60 µL

KLK14 Polyclonal Antibody

Sign In for Pricing
View Details