Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Gastric inhibitory polypeptide receptor (GIPR), partial

This Recombinant Macaca fascicularis Gastric inhibitory polypeptide receptor (GIPR), partial spans the amino acid sequence from region 26-138aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A2K5VD75

Expression Region

26-138aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Gastroenterology & Hepatology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSEGQTAGELYQRWERYRRECQETLATAEPPSGLACNGSFDMYVCWNYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHOSPHO1 Recombinant Protein (Rat)
RP220385 100 µg

PHOSPHO1 Recombinant Protein (Rat)

Sign In for Pricing
View Details
HBV Antibody
orb3131666-01 1 mg

HBV Antibody

Sign In for Pricing
View Details
HBV Antibody
orb3131666-02 5 mg

HBV Antibody

Sign In for Pricing
View Details
Olr476 Protein Vector (Rat) (pPM-C-His)
PV290177 500 ng

Olr476 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Anti-GTPBP4 Antibody Picoband® Fluoro647 Conjugated
A10450-2-Fluoro647 100 µg/Vial

Anti-GTPBP4 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
HMGB3P19 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV763105 1.0 µg DNA

HMGB3P19 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details