Recombinant Human N-formyl peptide receptor 2 (FPR2) -VLPs
This Recombinant Human N-formyl peptide receptor 2 (FPR2) -VLPs spans the amino acid sequence from region 1-351aa. Purity: The purity information is not available for VLPs proteins.
Product Specifications
Product Name Alternative
FMLP-related receptor I (FMLP-R-I) ; Formyl peptide receptor-like 1; HM63; Lipoxin A4 receptor (LXA4 receptor) ; RFP
UniProt
P25090
Expression Region
1-351aa
Tag
C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
The purity information is not available for VLPs proteins.
Form
Lyophilized powder
Molecular Weight
40.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
AA Sequence
METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470040-100 1x 100 µL
CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040525-500 1x 500 µL
CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680012-500 1x 500 µL
Tyrosinase (T311), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400806-500 1x 500 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940149-100 1x 100 µL
CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details