Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (CSF2RA), partial

This Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (CSF2RA), partial spans the amino acid sequence from region 23-320aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CDw116; CD116

UniProt

P15509

Expression Region

23-320aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

63.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Klotho (KL) ELISA Kit
MBS2706485-01 24 Strip Well

Human Klotho (KL) ELISA Kit

Sign In for Pricing
View Details
Human Klotho (KL) ELISA Kit
MBS2706485-02 48 Well

Human Klotho (KL) ELISA Kit

Sign In for Pricing
View Details
Human Klotho (KL) ELISA Kit
MBS2706485-03 96 Well

Human Klotho (KL) ELISA Kit

Sign In for Pricing
View Details
Human Klotho (KL) ELISA Kit
MBS2706485-04 5x 96 Well

Human Klotho (KL) ELISA Kit

Sign In for Pricing
View Details
Human Klotho (KL) ELISA Kit
MBS2706485-05 10x 96 Well

Human Klotho (KL) ELISA Kit

Sign In for Pricing
View Details
B3GALT2 (NM_003783) Human Over-expression Lysate
LY401245 100 µg

B3GALT2 (NM_003783) Human Over-expression Lysate

Sign In for Pricing
View Details