Recombinant Human Somatostatin receptor type 5 (SSTR5) -VLPs
This Recombinant Human Somatostatin receptor type 5 (SSTR5) -VLPs spans the amino acid sequence from region 1-364aa. Purity: The purity information is not available for VLPs proteins.
Product Specifications
Product Name Alternative
SS-5-R; SS5-R; SS5R; SST5
UniProt
P35346
Expression Region
1-364aa
Tag
C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Cancer Biology; Pharmacology & Drug Discovery
Purity
The purity information is not available for VLPs proteins.
Form
Lyophilized powder
Molecular Weight
40.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
AA Sequence
MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
KPB1946S 50 µg
Swine Receptor Antagonist (IL-1RA) Polyclonal Antibody - Biotinylated
Sign In for Pricing
View Details ![VRK2 Mouse Monoclonal Antibody [Clone ID: LBI2A2]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
MBS9714265-01 48 Tests
Human Solute Carrier Family 40 Member 1 (SLC40A1) ELISA Kit
Sign In for Pricing
View Details MBS9714265-02 96 Tests
Human Solute Carrier Family 40 Member 1 (SLC40A1) ELISA Kit
Sign In for Pricing
View Details MBS9714265-03 5x 96 Tests
Human Solute Carrier Family 40 Member 1 (SLC40A1) ELISA Kit
Sign In for Pricing
View Details