Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secreted and transmembrane protein 1 (SECTM1), partial, Biotinylated

This Recombinant Human Secreted and transmembrane protein 1 (SECTM1), partial spans the amino acid sequence from region 29-145aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein K-12

UniProt

Q8WVN6

Expression Region

29-145aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL
BNC680026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
BNC880050-100 1x 100 µL

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF594 conjugate, 0.1mg/mL
BNC940342-500 1x 500 µL

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF594 conjugate, 0.1mg/mL
BNC940305-500 1x 500 µL

CD95 (B-R18), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF647 conjugate, 0.1mg/mL
BNC471052-100 1x 100 µL

CD3e (B-B12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL
BNC741081-100 1x 100 µL

CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details