Recombinant Human Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial, Biotinylated
This Recombinant Human Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial, Biotinylated spans the amino acid sequence from region 51-183aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Glycoprotein Gp34; OX40 ligand (OX40L) ; TAX transcriptionally-activated glycoprotein 1
UniProt
P23510
Expression Region
51-183aa
Tag
N-terminal hFc-Avi-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Cancer Biology; Immunology & Inflammation
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
44.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740276-100 1x 100 µL
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042853-500 1x 500 µL
CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680391-100 1x 100 µL
CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740023-100 1x 100 µL
Thyroglobulin (2H11), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details