Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Erythropoietin receptor (Epor), partial

This Recombinant Mouse Erythropoietin receptor (Epor), partial spans the amino acid sequence from region 25-249aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EPO-R

UniProt

P14753

Expression Region

25-249aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAASSGMDFNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNORA63 CRISPRa sgRNA lentivector (set of three targets)(Human)
44637121 3x 1.0µg DNA

SNORA63 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Phospho-AKT1/AKT1 Rabbit Monoclonal Antibody
orb548565 100 µL

Phospho-AKT1/AKT1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Defb37 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6008204 1.0 µg DNA

Defb37 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
ME3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
28279156 3x 1.0 µg DNA

ME3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
C20orf196 Polyclonal Antibody, Biotin Conjugated
A66105-100 100 µL

C20orf196 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Snap29 Rabbit Polyclonal Antibody (Biotin)
orb2098609 100 µL

Snap29 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details