Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Thyrotropin subunit beta (Tshb), partial

This Recombinant Mouse Thyrotropin subunit beta (Tshb), partial spans the amino acid sequence from region 56-132aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thyroid-stimulating hormone subunit beta; TSH-B; TSH-beta; Thyrotropin beta chain

UniProt

P12656

Expression Region

56-132aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

INGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPHHVTPYFSFPVAVSCKCGKCNTDNSDCIHEAVRTNYCTKPQSFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine F13A1 (Coagulation Factor XIII A1 Polypeptide) ValidElisa Kit
EK344350 96 Well

Porcine F13A1 (Coagulation Factor XIII A1 Polypeptide) ValidElisa Kit

Sign In for Pricing
View Details
Acetone 99.9% Electronic Grade
0029G 02500 2.5 L

Acetone 99.9% Electronic Grade

Sign In for Pricing
View Details
Lentiviral mouse Bcat2 shRNA (UAS) - Lentiviral mouse Bcat2 shRNA (UAS, RFP) (25)
GTR15297902 1 Vial

Lentiviral mouse Bcat2 shRNA (UAS) - Lentiviral mouse Bcat2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
RSBN1 Rabbit Polyclonal Antibody (FITC)
orb2101992 100 µL

RSBN1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
RFWD2 Antibody
MBS9429806-01 0.1 mL

RFWD2 Antibody

Sign In for Pricing
View Details
RFWD2 Antibody
MBS9429806-02 5x 0.1 mL

RFWD2 Antibody

Sign In for Pricing
View Details