Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Inhibin beta C chain (Inhbc)

This Recombinant Rat Inhibin beta C chain (Inhbc) spans the amino acid sequence from region 237-351aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activin beta-C chain

UniProt

Q9WUK5

Expression Region

237-351aa

Tag

C-terminal 10xHis-HSA-tagged

Source

Mammalian cell

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

80.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

INCQGLSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCTGQCPLHVAGMPGISASFHTAVLNLLKANTDAGTARRGSCCVPTSRRPLSLLYYDRDSNIVKTDIPDMVVEACGCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

18alpha-Glycyrrhetinic Acid 3-O-beta-D-Glucuronide
TRC-G735155-10MG 10 mg

18alpha-Glycyrrhetinic Acid 3-O-beta-D-Glucuronide

Sign In for Pricing
View Details
WDR5 Polyclonal Antibody, Biotin Conjugated
A56834-100 100 µL

WDR5 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Lentiviral human FRZB shRNA (UAS) - Lentiviral human FRZB shRNA (UAS, RFP) (25)
GTR15162479 1 Vial

Lentiviral human FRZB shRNA (UAS) - Lentiviral human FRZB shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
YTHD3, ID (YTHDF3, YTH domain family protein 3) (MaxLight 490) discontinued
043970-ML490 100 µL

YTHD3, ID (YTHDF3, YTH domain family protein 3) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Bid Rabbit Polyclonal Antibody (Cy5)
orb2441379 100 µL

Bid Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
6-Chloro-2-(4-chlorophenyl)imidazo[1,2-a]pyridine-3-acetonitrile
TRC-C365630-50MG 50 mg

6-Chloro-2-(4-chlorophenyl)imidazo[1,2-a]pyridine-3-acetonitrile

Sign In for Pricing
View Details