Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Erythropoietin (EPO) (Active)

This Recombinant Human Erythropoietin (EPO) (Active) spans the amino acid sequence from region 28-193aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Erythropoietin; Epoetin

UniProt

P01588

Expression Region

28-193aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 0.3534 to 0.7096 ng/mL.

Form

Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCS Machine (Automatic sampling) BPTL-109-A
BPTL-109-A 1 Unit

CCS Machine (Automatic sampling) BPTL-109-A

Sign In for Pricing
View Details
CARD11 (18-238) Rabbit Polyclonal Antibody
AP23584PU-N 50 µL

CARD11 (18-238) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BDH2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G4]
TA501291BM 100 µL

BDH2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G4]

Sign In for Pricing
View Details
LINC02860 Human Gene Knockout Kit (CRISPR)
KN427450 1 Kit

LINC02860 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Protein A Biotin
BAP-01-2 2 mg

Protein A Biotin

Sign In for Pricing
View Details
Recombinant Rat IL-1β Protein (Sumo Tag)
PDER100247-01 20 µg

Recombinant Rat IL-1β Protein (Sumo Tag)

Sign In for Pricing
View Details