Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Erythropoietin (EPO) (Active)

This Recombinant Human Erythropoietin (EPO) (Active) spans the amino acid sequence from region 28-193aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Erythropoietin; Epoetin

UniProt

P01588

Expression Region

28-193aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 0.3534 to 0.7096 ng/mL.

Form

Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Luteolin-D6
TRC-L475004-10MG 10 mg

Luteolin-D6

Sign In for Pricing
View Details
EpCAM Antibody
F46203-0.08ML 0.08 mL

EpCAM Antibody

Sign In for Pricing
View Details
all-trans 5,6-Epoxy Retinoic Acid
TRC-E589800-1MG 1 mg

all-trans 5,6-Epoxy Retinoic Acid

Sign In for Pricing
View Details
Recombinant MBP Antibody
RC-5176-01 50 μL

Recombinant MBP Antibody

Sign In for Pricing
View Details
Recombinant MBP Antibody
RC-5176-02 100 µL

Recombinant MBP Antibody

Sign In for Pricing
View Details
Recombinant MBP Antibody
RC-5176-03 1 mL

Recombinant MBP Antibody

Sign In for Pricing
View Details