Recombinant Human Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1), partial (Active)
This Recombinant Human Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1), partial (Active) spans the amino acid sequence from region 25-103aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
ITPRIPL1; KIAA1754L; Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1
UniProt
Q6GPH6
Expression Region
25-103aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Pharmacology & Drug Discovery
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human ITPRIPL1 at 2 μg/mL can bind Anti-ITPRIPL1 recombinant antibody. The EC50 is 6.537-7.663 ng/mL.
Form
Lyophilized powder
Molecular Weight
10.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
HPLMVSDRMDLDTLARSRQLEKRMSEEMRLLEMEFEERKRAAEQRQKAENFWTGDTSSDQLVLGKKDMGWPFQADGQEG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942579-100 1x 100 µL
CD10 (Membrane Metalloendopeptidase) (MME/2579), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC140017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400753-100 1x 100 µL
Cytokeratin 19 (A53-B/A2.26 + BA17), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940948-100 1x 100 µL
Cytokeratin 5/8 (C-50), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741930-100 1x 100 µL
PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400408-500 1x 500 µL
TIMP3 (Rabbit PAb), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details