Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kit ligand (KITLG), partial (Active)

This Recombinant Human Kit ligand (KITLG), partial (Active) spans the amino acid sequence from region 26-189aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Kit ligand; Mast cell growth factor; Stem cell factor; c-Kit ligand; Soluble KIT ligand

UniProt

P21583

Expression Region

26-189aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of MO7e cells is 1.813-3.203 ng/mL.

Form

Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine5.5 Anti-Human CD25 Antibody[BC96]
E-AB-F1194I-01 20 Tests

PE/Cyanine5.5 Anti-Human CD25 Antibody[BC96]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD25 Antibody[BC96]
E-AB-F1194I-02 100 Tests

PE/Cyanine5.5 Anti-Human CD25 Antibody[BC96]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD25 Antibody[BC96]
E-AB-F1194I-03 2x 100 Tests

PE/Cyanine5.5 Anti-Human CD25 Antibody[BC96]

Sign In for Pricing
View Details
FAM38A/PIEZO1 Recombinant Mouse Monoclonal Antibody [2-10-R-A]
HA601100 100 µL

FAM38A/PIEZO1 Recombinant Mouse Monoclonal Antibody [2-10-R-A]

Sign In for Pricing
View Details
Recombinant XLF Antibody
RC-16032-01 50 μL

Recombinant XLF Antibody

Sign In for Pricing
View Details
Recombinant XLF Antibody
RC-16032-02 100 µL

Recombinant XLF Antibody

Sign In for Pricing
View Details