Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cysteine and glycine-rich protein 2 (CSRP2)

This Recombinant Human Cysteine and glycine-rich protein 2 (CSRP2) spans the amino acid sequence from region 1-193aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cysteine-rich protein 2 ; CRP2LIM domain only protein 5 ; LMO-5Smooth muscle cell LIM protein ; SmLIM

UniProt

Q16527

Expression Region

1-193aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology; Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polr2h AAV siRNA Pooled Vector
37179164 1.0 µg

Polr2h AAV siRNA Pooled Vector

Sign In for Pricing
View Details
MGAT4B Recombinant Protein Antigen
NBP3-17394PEP 100 µL

MGAT4B Recombinant Protein Antigen

Sign In for Pricing
View Details
MS4A8 Antibody
A70066-50UG 50 µg

MS4A8 Antibody

Sign In for Pricing
View Details
UNC79 Antibody, HRP conjugated
MBS7050044-01 0.05 mg

UNC79 Antibody, HRP conjugated

Sign In for Pricing
View Details
UNC79 Antibody, HRP conjugated
MBS7050044-02 0.1 mg

UNC79 Antibody, HRP conjugated

Sign In for Pricing
View Details
UNC79 Antibody, HRP conjugated
MBS7050044-03 5x 0.1 mg

UNC79 Antibody, HRP conjugated

Sign In for Pricing
View Details