Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cartilage-associated protein (CRTAP)

This Recombinant Human Cartilage-associated protein (CRTAP) spans the amino acid sequence from region 27-401aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CASP

UniProt

O75718

Expression Region

27-401aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QYERYSFRSFPRDELMPLESAYRHALDKYSGEHWAESVGYLEISLRLHRLLRDSEAFCHRNCSAAPQPEPAAGLASYPELRLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYFKANNLPKAIAAAHTFLLKHPDDEMMKRNMAYYKSLPGAEDYIKDLETKSYESLFIRAVRAYNGENWRTSITDMELALPDFFKAFYECLAACEGSREIKDFKDFYLSIADHYVEVLECKIQCEENLTPVIGGYPVEKFVATMYHYLQFAYYKLNDLKNAAPCAVSYLLFDQNDKVMQQNLVYYQYHRDTWGLSDEHFQPRPEAVQFFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEETS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-362-3p miRNA Inhibitor
orb1870470-01 10 nmol

Mmu-miR-362-3p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-362-3p miRNA Inhibitor
orb1870470-02 20 nmol

Mmu-miR-362-3p miRNA Inhibitor

Sign In for Pricing
View Details
FAK1 Antibody (Y576)
E45R05998G-4 50 µL

FAK1 Antibody (Y576)

Sign In for Pricing
View Details
TMEM16C Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-12479R-BF350 100 µL

TMEM16C Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
PWP1 (Periodic Tryptophan Protein 1 Homolog, Keratinocyte Protein IEF SSP 9502, IEF-SSP-9502) (MaxLight 405)
MBS6391544-01 0.1 mL

PWP1 (Periodic Tryptophan Protein 1 Homolog, Keratinocyte Protein IEF SSP 9502, IEF-SSP-9502) (MaxLight 405)

Sign In for Pricing
View Details
PWP1 (Periodic Tryptophan Protein 1 Homolog, Keratinocyte Protein IEF SSP 9502, IEF-SSP-9502) (MaxLight 405)
MBS6391544-02 5x 0.1 mL

PWP1 (Periodic Tryptophan Protein 1 Homolog, Keratinocyte Protein IEF SSP 9502, IEF-SSP-9502) (MaxLight 405)

Sign In for Pricing
View Details