Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Sorbitol dehydrogenase (Sord)

This Recombinant Mouse Sorbitol dehydrogenase (Sord) spans the amino acid sequence from region 2-357aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SDH; SORD; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH

UniProt

Q64442

Expression Region

2-357aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAPAKGENLSLVVHGPGDIRLENYPIPELGPNDVLLKMHSVGICGSDVHYWEHGRIGDFVVKKPMVLGHEAAGTVTKVGELVKHLKPGDRVAIEPGVPREVDEYCKIGRYNLTPTIFFCATPPDDGNLCRFYKHNADFCYKLPDSVTFEEGALIEPLSVGIYACRRGSVSLGNKVLVCGAGPVGMVTLLVAKAMGAAQVVVTDLSASRLTKAKEVGADFTIQVGKETPQEIASKVESLLGSKPEVTIECTGAESSVQTGIYATHSGGTLVIVGMGAEMVNLPLVHAAIREVDIKGVFRYCNTWPMAISMLASKTLNVKPLVTHRFPLEKAVEAFETAKKGVGLKVMIKCDPNDQNP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human anti-human CD103 mAb
E4A09C50-50 50 µg

Human anti-human CD103 mAb

Sign In for Pricing
View Details
MTBP Rabbit Polyclonal Antibody (Fluoro550)
orb3098148 100 µg

MTBP Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Lentiviral human LMF1 sgRNA gene knockout kit - Lentiviral human LMF1 sgRNA gene knockout kit (100)
GTR15376522 1 Vial

Lentiviral human LMF1 sgRNA gene knockout kit - Lentiviral human LMF1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
PNKD Protein Vector (Human) (pPM-C-HA)
PV031903 500 ng

PNKD Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
GPR156 Polyclonal Antibody
orb1413570 100 µL

GPR156 Polyclonal Antibody

Sign In for Pricing
View Details
SMARCB1 Adenovirus (Human)
44413051 1.0 mL

SMARCB1 Adenovirus (Human)

Sign In for Pricing
View Details