Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Apolipoprotein E (APOE)

This Recombinant Macaca mulatta Apolipoprotein E (APOE) spans the amino acid sequence from region 19-295aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apo-E

UniProt

Q28502

Expression Region

19-295aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Metabolism Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KVEQPVEPETEPELRQQAEGQSGQPWELALGRFWDYLRWVQTLSEQVQEELLSPQVTQELTTLMDETMKELKAYKSELEEQLSPVAEETRARLSKELQAAQARLGADMEDVRSRLVQYRSEVQAMLGQSTEELRARLASHLRKLRKRLLRDADDLQKRLARLGPLVEQGRVRAATVGSLASQPLQERAQAKLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQISLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGASTAPVPSDNH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRP5 discontinued
391179 200 µL

LRP5 discontinued

Sign In for Pricing
View Details
TCPTP/PTPN2 Rabbit Polyclonal Antibody (Fluoro488)
orb3077104 100 µg

TCPTP/PTPN2 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
RGS18 Antibody, HRP conjugated
CSB-PA019649LB01HU-01 50 µg

RGS18 Antibody, HRP conjugated

Sign In for Pricing
View Details
RGS18 Antibody, HRP conjugated
CSB-PA019649LB01HU-02 100 µg

RGS18 Antibody, HRP conjugated

Sign In for Pricing
View Details
Lentiviral human TNNI1 shRNA (UAS) - Lentiviral human TNNI1 shRNA (UAS, iRFP) (100)
GTR15351486 1 Vial

Lentiviral human TNNI1 shRNA (UAS) - Lentiviral human TNNI1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
C1orf201 Rabbit Polyclonal Antibody (HRP)
orb470653 100 µL

C1orf201 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details