Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Alpha-crystallin A chain (Cryaa)

This Recombinant Rat Alpha-crystallin A chain (Cryaa) spans the amino acid sequence from region 1-196aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P24623

Expression Region

1-196aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVTIQHPWFKRALGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISELMTHMWFVMHQPHAGNPKNNPGKVRSDRDKFVIFLDVKHFSPEDLTVKVLEDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKVQSGLDAGHSERAIPVSREEKPSSAPSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICMT Rabbit Polyclonal Antibody (BF594)
orb2387825 100 µL

ICMT Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
HSP47 Recombinant Antibody
bsm-61347R-01 20 µL

HSP47 Recombinant Antibody

Sign In for Pricing
View Details
HSP47 Recombinant Antibody
bsm-61347R-02 100 µL

HSP47 Recombinant Antibody

Sign In for Pricing
View Details
ZBTB25 Peptide - middle region (AAP33532)
AAP33532-100UG 100 µg

ZBTB25 Peptide - middle region (AAP33532)

Sign In for Pricing
View Details
PRRT4 CRISPR Activation Plasmid (h2)
sc-417643-ACT-2 20 µg

PRRT4 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Glypican 3 Antibody, mAb, Rabbit
A03727-100 100 µL

Glypican 3 Antibody, mAb, Rabbit

Sign In for Pricing
View Details