Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Medicago sativa Leghemoglobin-1

This Recombinant Medicago sativa Leghemoglobin-1 spans the amino acid sequence from region 1-147aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Leghemoglobin I

UniProt

P09187

Expression Region

1-147aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Medicago sativa (Alfalfa)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSFTDKQEALVNSSWEAFKQNLPRYSVFFYTVVLEKAPAAKGLFSFLKNSAEVQDSPQLQAHAEKVFGLVRDSAVQLRATGGVVLGDATLGAIHVRKGVVDPHFVVVKEALLKTIKEAAGDKWSEELNTAWEVAYDALATAIKKAMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human IL23R shRNA (UAS) - Lentiviral human IL23R shRNA (UAS, RFP) plasmid
GTR15337948 1 Vial

Lentiviral human IL23R shRNA (UAS) - Lentiviral human IL23R shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
CDY10P siRNA Oligos set (Human)
15773171 3x 5 nmol

CDY10P siRNA Oligos set (Human)

Sign In for Pricing
View Details
DUXAP8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0641905 3x 1.0 µg

DUXAP8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Fish 17β-E2 ELISA Kit
E109852 1 Each

Fish 17β-E2 ELISA Kit

Sign In for Pricing
View Details
Lcmt2 (NM_177846) Mouse Recombinant Protein
TP515677 20 µg

Lcmt2 (NM_177846) Mouse Recombinant Protein

Sign In for Pricing
View Details
Chicken Caveolin 1 (CAV1) ELISA Kit
orb1667426-01 48 Tests

Chicken Caveolin 1 (CAV1) ELISA Kit

Sign In for Pricing
View Details