Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Medicago sativa Leghemoglobin-1

This Recombinant Medicago sativa Leghemoglobin-1 spans the amino acid sequence from region 1-147aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Leghemoglobin I

UniProt

P09187

Expression Region

1-147aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Medicago sativa (Alfalfa)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSFTDKQEALVNSSWEAFKQNLPRYSVFFYTVVLEKAPAAKGLFSFLKNSAEVQDSPQLQAHAEKVFGLVRDSAVQLRATGGVVLGDATLGAIHVRKGVVDPHFVVVKEALLKTIKEAAGDKWSEELNTAWEVAYDALATAIKKAMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM42 Protein Vector (Human) (pPB-N-His)
PV034618 500 ng

RBM42 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Monkey BPI Fold-Containing Family A Member 4 (BPIFA4) ELISA Kit
MBS9932695-01 48 Well

Monkey BPI Fold-Containing Family A Member 4 (BPIFA4) ELISA Kit

Sign In for Pricing
View Details
Monkey BPI Fold-Containing Family A Member 4 (BPIFA4) ELISA Kit
MBS9932695-02 96 Well

Monkey BPI Fold-Containing Family A Member 4 (BPIFA4) ELISA Kit

Sign In for Pricing
View Details
Monkey BPI Fold-Containing Family A Member 4 (BPIFA4) ELISA Kit
MBS9932695-03 5x 96 Well

Monkey BPI Fold-Containing Family A Member 4 (BPIFA4) ELISA Kit

Sign In for Pricing
View Details
Monkey BPI Fold-Containing Family A Member 4 (BPIFA4) ELISA Kit
MBS9932695-04 10x 96 Well

Monkey BPI Fold-Containing Family A Member 4 (BPIFA4) ELISA Kit

Sign In for Pricing
View Details
GS-9620
A3444-5.1 10 mM (in 1mL DMSO)

GS-9620

Sign In for Pricing
View Details