Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Osteocalcin (BGLAP)

This Recombinant Bovine Osteocalcin (BGLAP) spans the amino acid sequence from region 52-100aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bone Gla protein; BGP; Gamma-carboxyglutamic acid-containing protein

UniProt

P02820

Expression Region

52-100aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YLDHWLGAPAPYPDPLEPKREVCELNPDCDELADHIGFQEAYRRFYGPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1700024P16Rik 3'UTR GFP Stable Cell Line
TU150213 1.0 mL

1700024P16Rik 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Kcnh1 Mouse siRNA Oligo Duplex (Locus ID 16510)
SR421457 1 Kit

Kcnh1 Mouse siRNA Oligo Duplex (Locus ID 16510)

Sign In for Pricing
View Details
WDYHV1 Antibody Blocking peptide
orb1450599 500 µg

WDYHV1 Antibody Blocking peptide

Sign In for Pricing
View Details
Cow Follistatin (FST) (FST) ELISA Kit
abx512797 96 Tests

Cow Follistatin (FST) (FST) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal ACE/CD143 Antibody (ACE/3765) [Alexa Fluor 532]
NBP3-08497AF532 100 µL

Mouse Monoclonal ACE/CD143 Antibody (ACE/3765) [Alexa Fluor 532]

Sign In for Pricing
View Details
ZNF263 (Zinc Finger Protein 263, FPM315, ZKSCAN12) (AP) discontinued
253711-AP 100 µL

ZNF263 (Zinc Finger Protein 263, FPM315, ZKSCAN12) (AP) discontinued

Sign In for Pricing
View Details