Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 23 (FGF23), partial

This Recombinant Human Fibroblast growth factor 23 (FGF23), partial spans the amino acid sequence from region 180-251aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FGF-23; Phosphatonin; Tumor-derived hypophosphatemia-inducing factor

UniProt

Q9GZV9

Expression Region

180-251aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MOS (NM_005372) AAV Particle
RC210144A1V 250 µL

Human MOS (NM_005372) AAV Particle

Sign In for Pricing
View Details
KLHL6 (NM_130446) Human Recombinant Protein
PH38592M5 20 µg

KLHL6 (NM_130446) Human Recombinant Protein

Sign In for Pricing
View Details
Ac-DEVD-AFC
C03753-5mg 5 mg

Ac-DEVD-AFC

Sign In for Pricing
View Details
HMOX2 Polyclonal Antibody
RA32657-01 50 µL

HMOX2 Polyclonal Antibody

Sign In for Pricing
View Details
HMOX2 Polyclonal Antibody
RA32657-02 100 µL

HMOX2 Polyclonal Antibody

Sign In for Pricing
View Details
PKD2L2 (Center) Rabbit pAb
E2613988 100 µL

PKD2L2 (Center) Rabbit pAb

Sign In for Pricing
View Details