Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peptide deformylase, mitochondrial (PDF)

This Recombinant Human Peptide deformylase, mitochondrial (PDF) spans the amino acid sequence from region 40-243aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Polypeptide deformylase

UniProt

Q9HBH1

Expression Region

40-243aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EGPALRRSYWRHLRRLVLGPPEPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPRQVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem80 Mouse qPCR Template Standard (NM_027797)
MK203461 1 Kit

Tmem80 Mouse qPCR Template Standard (NM_027797)

Sign In for Pricing
View Details
HARS Rabbit Monoclonal Antibody
E56G2717 100 µL

HARS Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
LRG1 Protein Vector (Human) (pPB-C-His)
PV024257 500 ng

LRG1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
MEA1 Protein Vector (Human) (pPM-C-His)
PV025420 500 ng

MEA1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Apolipoprotein D/APOD Rabbit Polyclonal Antibody (Fluoro488)
orb3083244 100 µg

Apolipoprotein D/APOD Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Recombinant Human PTH Protein
CRP2178-01 10 µg

Recombinant Human PTH Protein

Sign In for Pricing
View Details