Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Microtubule-associated proteins 1A/1B light chain 3B (Map1lc3b)

This Recombinant Mouse Microtubule-associated proteins 1A/1B light chain 3B (Map1lc3b) spans the amino acid sequence from region 2-120aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Autophagy-related protein LC3 B; Autophagy-related ubiquitin-like modifier LC3 B; MAP1 light chain 3-like protein 2; MAP1A/MAP1B light chain 3 B; MAP1A/MAP1B LC3 B; Microtubule-associated protein 1 light chain 3 beta

UniProt

Q9CQV6

Expression Region

2-120aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation; Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Macrophage antibody (FITC)
60R-MR006FT 2 mg

Mouse Macrophage antibody (FITC)

Sign In for Pricing
View Details
Hepatitis B Surface Antigen (HBsAg) Antibody
abx021808 1 mg

Hepatitis B Surface Antigen (HBsAg) Antibody

Sign In for Pricing
View Details
TRNAP3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV753215 1.0 µg DNA

TRNAP3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Delta 7-avenasterol
orb1682795 5 mg

Delta 7-avenasterol

Sign In for Pricing
View Details
Lentiviral human EDF1 shRNA (UAS) - Lentiviral human EDF1 shRNA (UAS) plasmid
GTR15351142 1 Vial

Lentiviral human EDF1 shRNA (UAS) - Lentiviral human EDF1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
D2Wsu81e ORF Vector (Mouse) (pORF)
17592014 1.0 µg DNA

D2Wsu81e ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details