Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sal-like protein 4 (SALL4), partial

This Recombinant Human Sal-like protein 4 (SALL4), partial spans the amino acid sequence from region 868-921aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger protein 797; Zinc finger protein SALL4

UniProt

Q9UJQ4

Expression Region

868-921aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KQHGCTRCGKNFSSASALQIHERTHTGEKPFVCNICGRAFTTKGNLKVHYMTHG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAD (Center) Rabbit Polyclonal Antibody
AP50710PU-N 400 µL

CAD (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Integrin alpha 6 (ITGA6) Human Gene Knockout Kit (CRISPR)
KN421990 1 Kit

Integrin alpha 6 (ITGA6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BAI1 (ADGRB1) Human Gene Knockout Kit (CRISPR)
KN424196 1 Kit

BAI1 (ADGRB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ATM Recombinant Rabbit Monoclonal Antibody [SI70-01]
ET1606-20 100 µL

ATM Recombinant Rabbit Monoclonal Antibody [SI70-01]

Sign In for Pricing
View Details
PRAMEF13 Human Gene Knockout Kit (CRISPR)
KN425804 1 Kit

PRAMEF13 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD1a (O10), CF568 conjugate, 0.1mg/mL
BNC680667-100 1x 100 µL

CD1a (O10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details