Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sal-like protein 4 (SALL4), partial

This Recombinant Human Sal-like protein 4 (SALL4), partial spans the amino acid sequence from region 868-921aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger protein 797; Zinc finger protein SALL4

UniProt

Q9UJQ4

Expression Region

868-921aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KQHGCTRCGKNFSSASALQIHERTHTGEKPFVCNICGRAFTTKGNLKVHYMTHG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coelenterazine H
#10111-2 1x 250 µg

Coelenterazine H

Sign In for Pricing
View Details
Ferritin, Heavy Chain (FTH) (Microglia Marker) (FTH/2081), CF594 conjugate, 0.1mg/mL
BNC942081-500 1x 500 µL

Ferritin, Heavy Chain (FTH) (Microglia Marker) (FTH/2081), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,10-Phenanthroline
TRC-P295040-1G 1 g

1,10-Phenanthroline

Sign In for Pricing
View Details
ZAP70 (ZAP70/528 + 2F3.2), CF640R conjugate, 0.1mg/mL
BNC401137-500 1x 500 µL

ZAP70 (ZAP70/528 + 2F3.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CIB1 (1-191) Mouse Monoclonal Antibody [Clone ID: 1D1]
AM03117PU-N 100 µL

CIB1 (1-191) Mouse Monoclonal Antibody [Clone ID: 1D1]

Sign In for Pricing
View Details
C1QTNF9 (NM_001303138) Human Tagged ORF Clone
RG237508 10 µg

C1QTNF9 (NM_001303138) Human Tagged ORF Clone

Sign In for Pricing
View Details