Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aeromonas hydrophila Major cold-shock protein (cspA)

This Recombinant Aeromonas hydrophila Major cold-shock protein (cspA) spans the amino acid sequence from region 1-46aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q44078

Expression Region

1-46aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Aeromonas hydrophila

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EKGFGFISPTDGSKDVFVHFSAIQTPGFKTLDEGQRVEFTIEQGQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TK2, NT (Thymidine Kinase 2, Mitochondrial, Mt-TK) (FITC)
MBS6502561-01 0.2 mL

TK2, NT (Thymidine Kinase 2, Mitochondrial, Mt-TK) (FITC)

Sign In for Pricing
View Details
TK2, NT (Thymidine Kinase 2, Mitochondrial, Mt-TK) (FITC)
MBS6502561-02 5x 0.2 mL

TK2, NT (Thymidine Kinase 2, Mitochondrial, Mt-TK) (FITC)

Sign In for Pricing
View Details
Slc35b2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3442308 1.0 µg DNA

Slc35b2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
H-Lys(2-chloro-Z)-OH
E-2725.0005 5.0g

H-Lys(2-chloro-Z)-OH

Sign In for Pricing
View Details
Recombinant Human PIM2 Protein
NBP2-51711-0.05mg 0.05 mg

Recombinant Human PIM2 Protein

Sign In for Pricing
View Details
Canine Opacity-associated proteins (OPAs) ELISA Kit
MBS2608033-01 48 Well

Canine Opacity-associated proteins (OPAs) ELISA Kit

Sign In for Pricing
View Details