Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Insulin-like growth factor II (IGF2)

This Recombinant Bovine Insulin-like growth factor II (IGF2) spans the amino acid sequence from region 25-91aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IGF-II; Erythrotropin

UniProt

P07456

Expression Region

25-91aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPSSRINRRSRGIVEECCFRSCDLALLETYCATPAKSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPN1, ID (PTPN1, PTP1B, Tyrosine-protein phosphatase non-receptor type 1, Protein-tyrosine phosphatase 1B) (FITC) discontinued
040658-FITC 200 µL

PTPN1, ID (PTPN1, PTP1B, Tyrosine-protein phosphatase non-receptor type 1, Protein-tyrosine phosphatase 1B) (FITC) discontinued

Sign In for Pricing
View Details
Olfr1427 Lentiviral Activation Particles (m)
sc-434795-LAC 200 µL

Olfr1427 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Fibronectin Active Fragment (RGDS)
4171-v 0.5 mg

Fibronectin Active Fragment (RGDS)

Sign In for Pricing
View Details
TP53INP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
47335061 1.0 µg DNA

TP53INP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ECH1 Rabbit Polyclonal Antibody
TA366210 100 µL

ECH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Slc1a2 shRNA (UAS) - Lentiviral mouse Slc1a2 shRNA (UAS, RFP) (100)
GTR15287928 1 Vial

Lentiviral mouse Slc1a2 shRNA (UAS) - Lentiviral mouse Slc1a2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details