Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis NAD (P) H dehydrogenase (quinone) (lpdA)

This Recombinant Mycobacterium tuberculosis NAD (P) H dehydrogenase (quinone) (lpdA) spans the amino acid sequence from region 1-493aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P; quinone; NAD (P; NAD (P; NADH-menadione reductase)

UniProt

P9WHH7

Expression Region

1-493aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCDGIGGAAVLDDCVPSKTFIASTGLRTELRRAPHLGFHIDFDDAKISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDSTPGLARHRIKATAADGSTSEHEADVVLVATGASPRILPSAQPDGERILTWRQLYDLDALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPYEDADAALVLEESFAERGVRLFKNARAASVTRTGAGVLVTMTDGRTVEGSHALMTIGSVPNTSGLGLERVGIQLGRGNYLTVDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAATVFTRPEIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMAHDDLDCTAAQDAAEQLALVPHHLPTSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLRD1 ORF Vector (Human) (pORF)
25880011 1.0 µg DNA

KLRD1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Zinc Finger Protein 184 (ZNF184) Antibody
abx239663 100 µg

Zinc Finger Protein 184 (ZNF184) Antibody

Sign In for Pricing
View Details
Abcc6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6947508 1.0 µg DNA

Abcc6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal ASXL2 Antibody [DyLight 594]
NBP1-18926DL594 0.1 mL

Rabbit Polyclonal ASXL2 Antibody [DyLight 594]

Sign In for Pricing
View Details
Anti-SUZ12 Rabbit Monoclonal Antibody
MBS179378-01 0.03 mL

Anti-SUZ12 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-SUZ12 Rabbit Monoclonal Antibody
MBS179378-02 0.1 mL

Anti-SUZ12 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details