Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lambda-carrageenase (cglA), partial

This Recombinant Lambda-carrageenase (cglA), partial spans the amino acid sequence from region 26-163aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q05JY7

Expression Region

26-163aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Pseudoalteromonas sp

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQSAIKSIETNRTITKVRTGMLSGGSSIITTSYEGTVAAYKFNGEKLWENELSGFMNHDIWVQDINGDGLVEIFAANADGNVYCINSDGSLKWTFGLNEVPMNSVTVISDADEKYVVAGGYDKNLYYISANGELLKTI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFIB Polyclonal Antibody, FITC Conjugated
bs-11899R-FITC-TR 20 µL

NFIB Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Rabbit Anti-FLT3 Polyclonal Antibody
PAV7299 100 μL

Rabbit Anti-FLT3 Polyclonal Antibody

Sign In for Pricing
View Details
Factor B Rabbit Polyclonal Antibody
orb1741886 100 µL

Factor B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
D330045A20Rik ORF Vector (Mouse) (pORF)
ORF042537 1.0 µg DNA

D330045A20Rik ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Lentiviral mouse Adcyap1r1 shRNA (UAS) - Lentiviral mouse Adcyap1r1 shRNA (UAS, RFP) (25)
GTR15249995 1 Vial

Lentiviral mouse Adcyap1r1 shRNA (UAS) - Lentiviral mouse Adcyap1r1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
RUNX1 / AML1 + RUNX3 + RUNX2 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb971322 100 µL

RUNX1 / AML1 + RUNX3 + RUNX2 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details