Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lambda-carrageenase (cglA), partial

This Recombinant Lambda-carrageenase (cglA), partial spans the amino acid sequence from region 26-163aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q05JY7

Expression Region

26-163aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Pseudoalteromonas sp

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQSAIKSIETNRTITKVRTGMLSGGSSIITTSYEGTVAAYKFNGEKLWENELSGFMNHDIWVQDINGDGLVEIFAANADGNVYCINSDGSLKWTFGLNEVPMNSVTVISDADEKYVVAGGYDKNLYYISANGELLKTI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEX2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2359007 1.0 µg DNA

TEX2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mouse SLC2A3 Recombinant Protein (N-GST & C-His)
MY305012-01 50 µg

Mouse SLC2A3 Recombinant Protein (N-GST & C-His)

Sign In for Pricing
View Details
Mouse SLC2A3 Recombinant Protein (N-GST & C-His)
MY305012-02 100 µg

Mouse SLC2A3 Recombinant Protein (N-GST & C-His)

Sign In for Pricing
View Details
Mouse SLC2A3 Recombinant Protein (N-GST & C-His)
MY305012-03 1 mg

Mouse SLC2A3 Recombinant Protein (N-GST & C-His)

Sign In for Pricing
View Details
TTBK1 CRISPR Activation Plasmid (m)
sc-430673-ACT 20 µg

TTBK1 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) TOR Polyclonal Antibody
MBS9006949 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) TOR Polyclonal Antibody

Sign In for Pricing
View Details