Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon gamma (IFNG)

This Recombinant Human Interferon gamma (IFNG) spans the amino acid sequence from region 24-166aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immune interferon

UniProt

P01579

Expression Region

24-166aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psrc1 Mouse Gene Knockout Kit (CRISPR)
KN514142 1 Kit

Psrc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PCYT1A (NM_005017) Human Recombinant Protein
TP308130M 100 µg

PCYT1A (NM_005017) Human Recombinant Protein

Sign In for Pricing
View Details
Superoxide Dismutase 1 (SOD1) (Antioxidant Enzyme) (SOD1/2089), CF640R conjugate, 0.1mg/mL
BNC402089-500 1x 500 µL

Superoxide Dismutase 1 (SOD1) (Antioxidant Enzyme) (SOD1/2089), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant EIF4EBP1 Antibody
RC-7043-01 50 μL

Recombinant EIF4EBP1 Antibody

Sign In for Pricing
View Details
Recombinant EIF4EBP1 Antibody
RC-7043-02 100 µL

Recombinant EIF4EBP1 Antibody

Sign In for Pricing
View Details
Recombinant EIF4EBP1 Antibody
RC-7043-03 1 mL

Recombinant EIF4EBP1 Antibody

Sign In for Pricing
View Details