Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C motif chemokine 5 (CCL5)

This Recombinant Human C-C motif chemokine 5 (CCL5) spans the amino acid sequence from region 24-91aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EoCPEosinophil chemotactic cytokine; SIS-delta; Small-inducible cytokine A5T cell-specific protein P228 ; TCP228T-cell-specific protein RANTES

UniProt

P13501

Expression Region

24-91aa

Tag

N-terminal 6xHis-tagged and C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human E2F1 pAb
PA10424-01 50 μL

Rabbit Anti-Human E2F1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human E2F1 pAb
PA10424-02 100 μL

Rabbit Anti-Human E2F1 pAb

Sign In for Pricing
View Details
Arrdc4 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3019002 1.0 µg DNA

Arrdc4 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
CBX8, ID (CBX8, PC3, RC1, Chromobox protein homolog 8, Polycomb 3 homolog, Rectachrome 1)
033257 200 µL

CBX8, ID (CBX8, PC3, RC1, Chromobox protein homolog 8, Polycomb 3 homolog, Rectachrome 1)

Sign In for Pricing
View Details
Relt sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3895803 1.0 µg DNA

Relt sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
PDCD6 Human Gene Knockout Kit (CRISPR)
KN402030 1 Kit

PDCD6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details