Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Profilin (chic)

This Recombinant Drosophila melanogaster Profilin (chic) spans the amino acid sequence from region 1-126aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein chickadee

UniProt

P25843

Expression Region

1-126aa

Tag

N-terminal 6xHis-tagged and C-terminal 6xHis-tagged

Source

E.coli

Origin

Drosophila melanogaster (Fruit fly)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSWQDYVDNQLLASQCVTKACIAGHDGNIWAQSSGFEVTKEELSKLISGFDQQDGLTSNGVTLAGQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDYLITCGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRP8 ORF Vector (Human) (pORF)
42760011 1.0 µg DNA

RRP8 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
GAD67 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-1302R-BF405-01 20 µL

GAD67 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
GAD67 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-1302R-BF405-02 100 µL

GAD67 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
CD8A Mouse Monoclonal Antibody [Clone ID: MEM-31]
SM3102P 100 µg

CD8A Mouse Monoclonal Antibody [Clone ID: MEM-31]

Sign In for Pricing
View Details
EGR1 Rabbit Polyclonal Antibody
TA330209 100 µL

EGR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FOXJ2 Conjugated Antibody
C36867 100 µL

FOXJ2 Conjugated Antibody

Sign In for Pricing
View Details