Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bunodosoma granuliferum Delta-actitoxin-Bgr2a

This Recombinant Bunodosoma granuliferum Delta-actitoxin-Bgr2a spans the amino acid sequence from region 1-48aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Delta-AITX-Bgr2a; Bg II; BgII; Neurotoxin Bg-2

UniProt

P0C1F4

Expression Region

1-48aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Bunodosoma granuliferum (Red warty sea anemone)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GASCRCDSDGPTSRGNTLTGTLWLIGRCPSGWHNCRGSGPFIGYCCKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Skin
CR561864 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
Retinol Binding Protein-1 (G4E4), CF568 conjugate, 0.1mg/mL
BNC680855-100 1x 100 µL

Retinol Binding Protein-1 (G4E4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STAT5A Human Knockdown Lysate
LY300434 100 µg

STAT5A Human Knockdown Lysate

Sign In for Pricing
View Details
Human MULticilin (MCIDAS) activation kit by CRISPRa
GA117615 1 Kit

Human MULticilin (MCIDAS) activation kit by CRISPRa

Sign In for Pricing
View Details
Human APRT activation kit by CRISPRa
GA100250 1 Kit

Human APRT activation kit by CRISPRa

Sign In for Pricing
View Details
2-(Hydroxyimino)-3-oxo-pentanedioic Acid 1,5-Diethyl Ester
TRC-H943315-50MG 50 mg

2-(Hydroxyimino)-3-oxo-pentanedioic Acid 1,5-Diethyl Ester

Sign In for Pricing
View Details