Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Profilin (chic)

This Recombinant Drosophila melanogaster Profilin (chic) spans the amino acid sequence from region 1-126aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein chickadee

UniProt

P25843

Expression Region

1-126aa

Tag

C-terminal 10xHis-tagged

Source

E.coli

Origin

Drosophila melanogaster (Fruit fly)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSWQDYVDNQLLASQCVTKACIAGHDGNIWAQSSGFEVTKEELSKLISGFDQQDGLTSNGVTLAGQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDYLITCGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome P450 20A1 Peptide
DF4760-BP 1 mg

Cytochrome P450 20A1 Peptide

Sign In for Pricing
View Details
Rat RAS Guanyl-Releasing Protein 1 (RASGRP1) ELISA Kit
abx526285 96 Tests

Rat RAS Guanyl-Releasing Protein 1 (RASGRP1) ELISA Kit

Sign In for Pricing
View Details
TRNAH5 Recombinant Protein (Human)
RP104231 100 µg

TRNAH5 Recombinant Protein (Human)

Sign In for Pricing
View Details
PMP2 Antibody
MBS9415776-01 0.1 mL

PMP2 Antibody

Sign In for Pricing
View Details
PMP2 Antibody
MBS9415776-02 5x 0.1 mL

PMP2 Antibody

Sign In for Pricing
View Details
KLC2 (NM_001134774) Human Tagged ORF Clone
RG225936 10 µg

KLC2 (NM_001134774) Human Tagged ORF Clone

Sign In for Pricing
View Details