Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Focadhesin (FOCAD), partial

This Recombinant Human Focadhesin (FOCAD), partial spans the amino acid sequence from region 1-150aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q5VW36

Expression Region

1-150aa

Tag

C-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSDDIRKRFEFPNSLIQSQAVGHLIAAVLKENGFSEKIHQSTNQTPALNLLWEKCCSDNVVVRTACCEGLVALVAQDHAEFSYVLNGILNLIPSTRNTHGLIKAIMHLLQMQALKEGQGGEKNIQSIYTIRNHPHPLITVLEHRPDCWPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Fcγ (Fc Fragment of IgG) ELISA Kit
EKE61918 96 Tests

Monkey Fcγ (Fc Fragment of IgG) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal TEM7/PLXDC1 Antibody [Allophycocyanin]
NBP2-99868APC 0.1 mL

Rabbit Polyclonal TEM7/PLXDC1 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
Protor-2 Double Nickase Plasmid (m2)
sc-428344-NIC-2 20 µg

Protor-2 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
PDGFA siRNA (Mouse)
CRM3002-01 15 nmol

PDGFA siRNA (Mouse)

Sign In for Pricing
View Details
PDGFA siRNA (Mouse)
CRM3002-02 30 nmol

PDGFA siRNA (Mouse)

Sign In for Pricing
View Details
Dcbld2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7117506 1.0 µg DNA

Dcbld2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details