Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Nephrin (Nphs1), partial

This Recombinant Mouse Nephrin (Nphs1), partial spans the amino acid sequence from region 36-250aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Renal glomerulus-specific cell adhesion receptor

UniProt

Q9QZS7

Expression Region

36-250aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology; Kidney & Urological Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQSPVPTSAPRGFWALSENLTVVEGSTVKLWCGVRAPGSVVQWAKDGLLLGPNPKIPGFPRYSLEGDSAKGEFHLLIEACDLSDDAEYECQVGRSELGPELVSPSVILSILVSPKVLQLTPEAGSTVTWVAGQEYVVTCVSGDAKPAPDIIFIQGGRTVEDVSSSVNEGSEEKLFFTEAEARVTPQSSDNGQLLVCEGSNPALATPIKASFTMNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC43A2 CytoSection
TS406639P5 25 Slides

SLC43A2 CytoSection

Sign In for Pricing
View Details
Exenatide Acetate (Exendin-4)
P1046-50mg 50 mg

Exenatide Acetate (Exendin-4)

Sign In for Pricing
View Details
NOTUM Antibody (C-term)
E45R14146G-4 50 µL

NOTUM Antibody (C-term)

Sign In for Pricing
View Details
SERTAD4 Overexpression Lysate (Native) - (Dry Ice)
NBL1-15863 0.1 mg

SERTAD4 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Compound Fr14481
Fr14481-01 200 mg

Compound Fr14481

Sign In for Pricing
View Details
Compound Fr14481
Fr14481-02 1 g

Compound Fr14481

Sign In for Pricing
View Details