Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcriptional enhancer factor TEF-5 (TEAD3), partial

This Recombinant Human Transcriptional enhancer factor TEF-5 (TEAD3), partial spans the amino acid sequence from region 112-435aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DTEF-1TEA domain family member 3 ; TEAD-3

UniProt

Q99594

Expression Region

112-435aa

Tag

C-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNLDQVSKDKALQSMASMSSAQIVSASVLQNKFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEYARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Erbin Rabbit Polyclonal Antibody
JOT-AP09695-01 20 µL

Erbin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Erbin Rabbit Polyclonal Antibody
JOT-AP09695-02 50 μL

Erbin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Erbin Rabbit Polyclonal Antibody
JOT-AP09695-03 100 µL

Erbin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Bromo-5-methoxy-3-methyl-1H-pyrazole
YEC61766-01 50 mg

4-Bromo-5-methoxy-3-methyl-1H-pyrazole

Sign In for Pricing
View Details
4-Bromo-5-methoxy-3-methyl-1H-pyrazole
YEC61766-02 0.5 g

4-Bromo-5-methoxy-3-methyl-1H-pyrazole

Sign In for Pricing
View Details
4933436I01Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
10774114 3x 1.0 µg

4933436I01Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details