Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcriptional enhancer factor TEF-3 (TEAD4), partial

This Recombinant Human Transcriptional enhancer factor TEF-3 (TEAD4), partial spans the amino acid sequence from region 217-434aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TEA domain family member 4

UniProt

Q15561

Expression Region

217-434aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant E.coli SRS (Seryl-tRNA synthetase) Protein
ARP4020-01 10 µg

Recombinant E.coli SRS (Seryl-tRNA synthetase) Protein

Sign In for Pricing
View Details
Recombinant E.coli SRS (Seryl-tRNA synthetase) Protein
ARP4020-02 50 µg

Recombinant E.coli SRS (Seryl-tRNA synthetase) Protein

Sign In for Pricing
View Details
Recombinant E.coli SRS (Seryl-tRNA synthetase) Protein
ARP4020-03 100 µg

Recombinant E.coli SRS (Seryl-tRNA synthetase) Protein

Sign In for Pricing
View Details
Recombinant E.coli SRS (Seryl-tRNA synthetase) Protein
ARP4020-04 1 mg

Recombinant E.coli SRS (Seryl-tRNA synthetase) Protein

Sign In for Pricing
View Details
RAF1, phosphorylated (Ser339) (RAF Proto-oncogene Serine/Threonine-protein Kinase, Proto-oncogene c-RAF, Raf-1, C-RAF, cRaf, RAF)
R0495-09W 200 µL

RAF1, phosphorylated (Ser339) (RAF Proto-oncogene Serine/Threonine-protein Kinase, Proto-oncogene c-RAF, Raf-1, C-RAF, cRaf, RAF)

Sign In for Pricing
View Details
Mouse Platelet-Derived Growth Factor AA,PDGF-AA ELISA KIT
JOT-EK2353Mo 96 wells

Mouse Platelet-Derived Growth Factor AA,PDGF-AA ELISA KIT

Sign In for Pricing
View Details